Anti-LTB
Artikelnummer:
ATA-HPA048884
- Bilder (9)
| Artikelname: | Anti-LTB |
| Artikelnummer: | ATA-HPA048884 |
| Hersteller Artikelnummer: | HPA048884 |
| Alternativnummer: | ATA-HPA048884-100,ATA-HPA048884-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p33, TNFC, TNFSF3 |
| lymphotoxin beta (TNF superfamily, member 3) |
| Anti-LTB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4050 |
| UniProt: | Q06643 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LTB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line RT4 shows localization to centrosome. |
|
|
Immunohistochemical staining of human cerebral cortex shows very weak positivity in neurons. |
|
|
Immunohistochemical staining of human small intestine shows moderate positivity in leukocytes. |
|
|
Immunohistochemical staining of human tonsil shows moderate positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human lymph node shows strong positivity in non-germinal center cells. |
|
|
HPA048884-100ul |
|
|
|
|
|
HPA048884-100ul |
|
|
HPA048884-100ul |
Produktgarantie und fachkundiger Support
