Anti-LTB
Catalog Number:
ATA-HPA048884
- Images (9)
| Article Name: | Anti-LTB |
| Biozol Catalog Number: | ATA-HPA048884 |
| Supplier Catalog Number: | HPA048884 |
| Alternative Catalog Number: | ATA-HPA048884-100,ATA-HPA048884-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | p33, TNFC, TNFSF3 |
| lymphotoxin beta (TNF superfamily, member 3) |
| Anti-LTB |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4050 |
| UniProt: | Q06643 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LTB |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line RT4 shows localization to centrosome. |
|
|
Immunohistochemical staining of human cerebral cortex shows very weak positivity in neurons. |
|
|
Immunohistochemical staining of human small intestine shows moderate positivity in leukocytes. |
|
|
Immunohistochemical staining of human tonsil shows moderate positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human lymph node shows strong positivity in non-germinal center cells. |
|
|
HPA048884-100ul |
|
|
|
|
|
HPA048884-100ul |
|
|
HPA048884-100ul |
Product Guarantee and Expert Support
