Anti-SLC5A5
Artikelnummer:
ATA-HPA049055
- Bilder (7)
| Artikelname: | Anti-SLC5A5 |
| Artikelnummer: | ATA-HPA049055 |
| Hersteller Artikelnummer: | HPA049055 |
| Alternativnummer: | ATA-HPA049055-100,ATA-HPA049055-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NIS |
| solute carrier family 5 (sodium/iodide cotransporter), member 5 |
| Anti-SLC5A5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6528 |
| UniProt: | Q92911 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC5A5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human salivary gland and placenta tissues using HPA049055 antibody. Corresponding SLC5A5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human salivary gland shows strong membranous positivity in glandular cells. |
|
|
HPA049055-100ul |
|
|
HPA049055-100ul |
|
|
HPA049055-100ul |
Produktgarantie und fachkundiger Support
