Anti-SLC5A5
Catalog Number:
ATA-HPA049055
- Images (7)
| Article Name: | Anti-SLC5A5 |
| Biozol Catalog Number: | ATA-HPA049055 |
| Supplier Catalog Number: | HPA049055 |
| Alternative Catalog Number: | ATA-HPA049055-100,ATA-HPA049055-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NIS |
| solute carrier family 5 (sodium/iodide cotransporter), member 5 |
| Anti-SLC5A5 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6528 |
| UniProt: | Q92911 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC5A5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human salivary gland and placenta tissues using HPA049055 antibody. Corresponding SLC5A5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human salivary gland shows strong membranous positivity in glandular cells. |
|
|
HPA049055-100ul |
|
|
HPA049055-100ul |
|
|
HPA049055-100ul |
Product Guarantee and Expert Support
