Anti-FAM83E
Artikelnummer:
ATA-HPA049305
- Bilder (7)
| Artikelname: | Anti-FAM83E |
| Artikelnummer: | ATA-HPA049305 |
| Hersteller Artikelnummer: | HPA049305 |
| Alternativnummer: | ATA-HPA049305-100,ATA-HPA049305-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20200 |
| family with sequence similarity 83, member E |
| Anti-FAM83E |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 54854 |
| UniProt: | Q2M2I3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQVSGTVREKFVLLDGERVISGSYS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM83E |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human stomach shows weak cytoplasmic/membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in tubules. |
|
|
HPA049305-100ul |
|
|
HPA049305-100ul |
|
|
HPA049305-100ul |
Produktgarantie und fachkundiger Support
