Anti-FAM83E
Catalog Number:
ATA-HPA049305
- Images (7)
| Article Name: | Anti-FAM83E |
| Biozol Catalog Number: | ATA-HPA049305 |
| Supplier Catalog Number: | HPA049305 |
| Alternative Catalog Number: | ATA-HPA049305-100,ATA-HPA049305-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ20200 |
| family with sequence similarity 83, member E |
| Anti-FAM83E |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 54854 |
| UniProt: | Q2M2I3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQVSGTVREKFVLLDGERVISGSYS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAM83E |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human stomach shows weak cytoplasmic/membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in tubules. |
|
|
HPA049305-100ul |
|
|
HPA049305-100ul |
|
|
HPA049305-100ul |
Product Guarantee and Expert Support
