Anti-TMED3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA049314
Artikelname: Anti-TMED3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA049314
Hersteller Artikelnummer: HPA049314
Alternativnummer: ATA-HPA049314-100,ATA-HPA049314-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C15orf22, p24B
transmembrane emp24 protein transport domain containing 3
Anti-TMED3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23423
UniProt: Q9Y3Q3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VGDEPPILPDMGNRVTALTQRFRGAYWKEVDKMVDYMQPGGTPATEGLGRLAPS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.