Anti-TMED3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA049314
| Article Name: |
Anti-TMED3, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA049314 |
| Supplier Catalog Number: |
HPA049314 |
| Alternative Catalog Number: |
ATA-HPA049314-100,ATA-HPA049314-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
C15orf22, p24B |
| transmembrane emp24 protein transport domain containing 3 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
23423 |
| UniProt: |
Q9Y3Q3 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
VGDEPPILPDMGNRVTALTQRFRGAYWKEVDKMVDYMQPGGTPATEGLGRLAPS |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:20 - 1:50 |
![]()
|
Immunohistochemical staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells. |
![]()
|
|
