Anti-KIF13B

Artikelnummer: ATA-HPA049655
Artikelname: Anti-KIF13B
Artikelnummer: ATA-HPA049655
Hersteller Artikelnummer: HPA049655
Alternativnummer: ATA-HPA049655-100,ATA-HPA049655-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GAKIN, KIAA0639
kinesin family member 13B
Anti-KIF13B
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 23303
UniProt: Q9NQT8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNPENRKSWAS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIF13B
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human parathyroid gland and skeletal muscle tissues using Anti-KIF13B antibody. Corresponding KIF13B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, lymph node, parathyroid gland and skeletal muscle using Anti-KIF13B antibody HPA049655 (A) shows similar protein distribution across tissues to independent antibody HPA025023 (B).
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-KIF13B antibody HPA049655.
Immunohistochemical staining of human kidney using Anti-KIF13B antibody HPA049655.
HPA049655-100ul
HPA049655-100ul
HPA049655-100ul