Anti-KIF13B

Product Overview

• Article Name: Anti-KIF13B
• Biozol Catalog Number: ATA-HPA049655
• Supplier Catalog Number: HPA049655
• Alternative Catalog Number: ATA-HPA049655-100,ATA-HPA049655-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GAKIN, KIAA0639

Product Description

kinesin family member 13B

Additional Information

Anti-KIF13B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 23303
• UniProt: Q9NQT8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNPENRKSWAS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KIF13B
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human parathyroid gland and skeletal muscle tissues using Anti-KIF13B antibody. Corresponding KIF13B RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney, lymph node, parathyroid gland and skeletal muscle using Anti-KIF13B antibody HPA049655 (A) shows similar protein distribution across tissues to independent antibody HPA025023 (B).

Immunohistochemical staining of human parathyroid gland shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human lymph node using Anti-KIF13B antibody HPA049655.

Immunohistochemical staining of human kidney using Anti-KIF13B antibody HPA049655.

HPA049655-100ul

HPA049655-100ul

HPA049655-100ul