Anti-TCF3
Artikelnummer:
ATA-HPA049808
- Bilder (9)
| Artikelname: | Anti-TCF3 |
| Artikelnummer: | ATA-HPA049808 |
| Hersteller Artikelnummer: | HPA049808 |
| Alternativnummer: | ATA-HPA049808-100,ATA-HPA049808-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR |
| transcription factor 3 |
| Anti-TCF3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6929 |
| UniProt: | P15923 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TCF3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human lymphoid tissues shows weak to moderate nuclear positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human gastrointestinal shows weak to moderate nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA049808-100ul |
|
|
|
|
|
HPA049808-100ul |
|
|
HPA049808-100ul |
Produktgarantie und fachkundiger Support
