Anti-TCF3
Catalog Number:
ATA-HPA049808
- Images (9)
| Article Name: | Anti-TCF3 |
| Biozol Catalog Number: | ATA-HPA049808 |
| Supplier Catalog Number: | HPA049808 |
| Alternative Catalog Number: | ATA-HPA049808-100,ATA-HPA049808-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR |
| transcription factor 3 |
| Anti-TCF3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6929 |
| UniProt: | P15923 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TCF3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human lymphoid tissues shows weak to moderate nuclear positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human gastrointestinal shows weak to moderate nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA049808-100ul |
|
|
|
|
|
HPA049808-100ul |
|
|
HPA049808-100ul |
Product Guarantee and Expert Support
