Anti-SALL1
Artikelnummer:
ATA-HPA049829
- Bilder (9)
| Artikelname: | Anti-SALL1 |
| Artikelnummer: | ATA-HPA049829 |
| Hersteller Artikelnummer: | HPA049829 |
| Alternativnummer: | ATA-HPA049829-100,ATA-HPA049829-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Hsal1, TBS, ZNF794 |
| spalt-like transcription factor 1 |
| Anti-SALL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6299 |
| UniProt: | Q9NSC2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SALL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
HPA049829-100ul |
|
|
|
|
|
HPA049829-100ul |
|
|
HPA049829-100ul |
Produktgarantie und fachkundiger Support
