Anti-SALL1
Catalog Number:
ATA-HPA049829
- Images (9)
| Article Name: | Anti-SALL1 |
| Biozol Catalog Number: | ATA-HPA049829 |
| Supplier Catalog Number: | HPA049829 |
| Alternative Catalog Number: | ATA-HPA049829-100,ATA-HPA049829-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Hsal1, TBS, ZNF794 |
| spalt-like transcription factor 1 |
| Anti-SALL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 6299 |
| UniProt: | Q9NSC2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SALL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
HPA049829-100ul |
|
|
|
|
|
HPA049829-100ul |
|
|
HPA049829-100ul |
Product Guarantee and Expert Support
