Anti-TEX44
Artikelnummer:
ATA-HPA049917
- Bilder (9)
| Artikelname: | Anti-TEX44 |
| Artikelnummer: | ATA-HPA049917 |
| Hersteller Artikelnummer: | HPA049917 |
| Alternativnummer: | ATA-HPA049917-100,ATA-HPA049917-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C2orf57, MGC35154 |
| testis expressed 44 |
| Anti-TEX44 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 165100 |
| UniProt: | Q53QW1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTATPRAISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TEX44 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human testis and kidney tissues using Anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-TEX44 antibody HPA049917 (A) shows similar protein distribution across tissues to independent antibody HPA056433 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TEX44 antibody HPA049917. |
|
|
Immunohistochemical staining of human lymph node using Anti-TEX44 antibody HPA049917. |
|
|
HPA049917-100ul |
|
|
HPA049917-100ul |
|
|
HPA049917-100ul |
Produktgarantie und fachkundiger Support
