Anti-TEX44

Catalog Number: ATA-HPA049917
Article Name: Anti-TEX44
Biozol Catalog Number: ATA-HPA049917
Supplier Catalog Number: HPA049917
Alternative Catalog Number: ATA-HPA049917-100,ATA-HPA049917-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2orf57, MGC35154
testis expressed 44
Anti-TEX44
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 165100
UniProt: Q53QW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTATPRAISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TEX44
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human testis and kidney tissues using Anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-TEX44 antibody HPA049917 (A) shows similar protein distribution across tissues to independent antibody HPA056433 (B).
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-TEX44 antibody HPA049917.
Immunohistochemical staining of human lymph node using Anti-TEX44 antibody HPA049917.
HPA049917-100ul
HPA049917-100ul
HPA049917-100ul