Anti-USP8
Artikelnummer:
ATA-HPA050215
- Bilder (9)
| Artikelname: | Anti-USP8 |
| Artikelnummer: | ATA-HPA050215 |
| Hersteller Artikelnummer: | HPA050215 |
| Alternativnummer: | ATA-HPA050215-100,ATA-HPA050215-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HumORF8, KIAA0055, SPG59, UBPY |
| ubiquitin specific peptidase 8 |
| Anti-USP8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9101 |
| UniProt: | P40818 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | USP8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate positivity in apical membrane in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate membranous and cytoplasmic positivity in glandular cells. |
|
|
HPA050215-100ul |
|
|
|
|
|
HPA050215-100ul |
|
|
HPA050215-100ul |
Produktgarantie und fachkundiger Support
