Anti-USP8, Rabbit, Polyclonal
Catalog Number:
ATA-HPA050215
- Images (9)
| Article Name: | Anti-USP8, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA050215 |
| Supplier Catalog Number: | HPA050215 |
| Alternative Catalog Number: | ATA-HPA050215-25,ATA-HPA050215-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HumORF8, KIAA0055, SPG59, UBPY |
| ubiquitin specific peptidase 8 |
| Anti-USP8 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9101 |
| UniProt: | P40818 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | USP8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate positivity in apical membrane in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate membranous and cytoplasmic positivity in glandular cells. |
|
|
HPA050215 |
|
|
|
|
|
HPA050215 |
|
|
HPA050215 |
Product Guarantee and Expert Support
