Anti-COL13A1
Artikelnummer:
ATA-HPA050392
- Bilder (7)
| Artikelname: | Anti-COL13A1 |
| Artikelnummer: | ATA-HPA050392 |
| Hersteller Artikelnummer: | HPA050392 |
| Alternativnummer: | ATA-HPA050392-100,ATA-HPA050392-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COL13A1 |
| collagen, type XIII, alpha 1 |
| Anti-COL13A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1305 |
| UniProt: | Q5TAT6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COL13A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lung shows weak to moderate membranous positivity in pneumocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-COL13A1 antibody. Corresponding COL13A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
|
|
|
HPA050392-100ul |
Produktgarantie und fachkundiger Support
