Anti-COL13A1
Catalog Number:
ATA-HPA050392
- Images (7)
| Article Name: | Anti-COL13A1 |
| Biozol Catalog Number: | ATA-HPA050392 |
| Supplier Catalog Number: | HPA050392 |
| Alternative Catalog Number: | ATA-HPA050392-100,ATA-HPA050392-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | COL13A1 |
| collagen, type XIII, alpha 1 |
| Anti-COL13A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1305 |
| UniProt: | Q5TAT6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COL13A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lung shows weak to moderate membranous positivity in pneumocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in human cell lines PC-3 and Caco-2 using Anti-COL13A1 antibody. Corresponding COL13A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
|
|
|
HPA050392-100ul |
Product Guarantee and Expert Support
