Anti-TET3 ChIP certified

Artikelnummer: ATA-HPA050845
Artikelname: Anti-TET3 ChIP certified
Artikelnummer: ATA-HPA050845
Hersteller Artikelnummer: HPA050845
Alternativnummer: ATA-HPA050845-100,ATA-HPA050845-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: hCG_40738, MGC22014
tet methylcytosine dioxygenase 3
Anti-TET3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 200424
UniProt: O43151
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TET3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemical staining of human placenta shows moderate nuclear positivity in a subset of cells in chorionic villi.
Immunohistochemical staining of human uterine cervix shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human duodenum shows weak nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
HPA050845-100ul
HPA050845-100ul
HPA050845-100ul