Anti-TET3, Rabbit, Polyclonal
Catalog Number:
ATA-HPA050845
- Images (9)
| Article Name: | Anti-TET3, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA050845 |
| Supplier Catalog Number: | HPA050845 |
| Alternative Catalog Number: | ATA-HPA050845-25,ATA-HPA050845-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hCG_40738, MGC22014 |
| tet methylcytosine dioxygenase 3 |
| Anti-TET3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 200424 |
| UniProt: | O43151 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TET3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & vesicles. |
|
|
Immunohistochemical staining of human placenta shows moderate nuclear positivity in a subset of cells in chorionic villi. |
|
|
Immunohistochemical staining of human uterine cervix shows moderate nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human duodenum shows weak nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA050845 |
|
|
|
|
|
HPA050845 |
|
|
HPA050845 |
Product Guarantee and Expert Support
