Anti-MSMB
Artikelnummer:
ATA-HPA051257
- Bilder (8)
| Artikelname: | Anti-MSMB |
| Artikelnummer: | ATA-HPA051257 |
| Hersteller Artikelnummer: | HPA051257 |
| Alternativnummer: | ATA-HPA051257-100,ATA-HPA051257-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94 |
| microseminoprotein, beta- |
| Anti-MSMB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4477 |
| UniProt: | P08118 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MSMB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-MSMB antibody. Corresponding MSMB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Prostate tissue |
|
|
HPA051257-100ul |
|
|
|
|
|
HPA051257-100ul |
|
|
HPA051257-100ul |
Produktgarantie und fachkundiger Support
