Anti-MSMB

Catalog Number: ATA-HPA051257
Article Name: Anti-MSMB
Biozol Catalog Number: ATA-HPA051257
Supplier Catalog Number: HPA051257
Alternative Catalog Number: ATA-HPA051257-100,ATA-HPA051257-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94
microseminoprotein, beta-
Anti-MSMB
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4477
UniProt: P08118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MSMB
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-MSMB antibody. Corresponding MSMB RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Prostate tissue
HPA051257-100ul
HPA051257-100ul
HPA051257-100ul