Anti-MSMB
Catalog Number:
ATA-HPA051257
- Images (8)
| Article Name: | Anti-MSMB |
| Biozol Catalog Number: | ATA-HPA051257 |
| Supplier Catalog Number: | HPA051257 |
| Alternative Catalog Number: | ATA-HPA051257-100,ATA-HPA051257-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94 |
| microseminoprotein, beta- |
| Anti-MSMB |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 4477 |
| UniProt: | P08118 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MSMB |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-MSMB antibody. Corresponding MSMB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Prostate tissue |
|
|
HPA051257-100ul |
|
|
|
|
|
HPA051257-100ul |
|
|
HPA051257-100ul |
Product Guarantee and Expert Support
