Anti-DEFA4
Artikelnummer:
ATA-HPA051266
- Bilder (8)
| Artikelname: | Anti-DEFA4 |
| Artikelnummer: | ATA-HPA051266 |
| Hersteller Artikelnummer: | HPA051266 |
| Alternativnummer: | ATA-HPA051266-100,ATA-HPA051266-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DEF4, HP-4 |
| defensin, alpha 4, corticostatin |
| Anti-DEFA4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1669 |
| UniProt: | P12838 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DEFA4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA051266 antibody. Corresponding DEFA4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows positivity in hematopoietic cells. |
|
|
Immunohistochemical staining of human lymph node shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human duodenum shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity as expected. |
|
|
HPA051266-100ul |
|
|
HPA051266-100ul |
|
|
HPA051266-100ul |
Produktgarantie und fachkundiger Support
