Anti-DEFA4
Catalog Number:
ATA-HPA051266
- Images (8)
| Article Name: | Anti-DEFA4 |
| Biozol Catalog Number: | ATA-HPA051266 |
| Supplier Catalog Number: | HPA051266 |
| Alternative Catalog Number: | ATA-HPA051266-100,ATA-HPA051266-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DEF4, HP-4 |
| defensin, alpha 4, corticostatin |
| Anti-DEFA4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1669 |
| UniProt: | P12838 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DEFA4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA051266 antibody. Corresponding DEFA4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows positivity in hematopoietic cells. |
|
|
Immunohistochemical staining of human lymph node shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human duodenum shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity as expected. |
|
|
HPA051266-100ul |
|
|
HPA051266-100ul |
|
|
HPA051266-100ul |
Product Guarantee and Expert Support
