Anti-KDM4E, Rabbit, Polyclonal

Artikelnummer: ATA-HPA051740
Artikelname: Anti-KDM4E, Rabbit, Polyclonal
Artikelnummer: ATA-HPA051740
Hersteller Artikelnummer: HPA051740
Alternativnummer: ATA-HPA051740-100,ATA-HPA051740-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: JMJD2E, KDM4DL
lysine (K)-specific demethylase 4E
Anti-KDM4E
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 390245
UniProt: B2RXH2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLTLGMSARVLLPSTGSWGSGRGR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human stomach, lower shows strong nuclear and cytoplasmic positivity in glandular cells.