Anti-KDM4E, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-KDM4E, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA051740
• Supplier Catalog Number: HPA051740
• Alternative Catalog Number: ATA-HPA051740-100,ATA-HPA051740-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: JMJD2E, KDM4DL

Product Description

lysine (K)-specific demethylase 4E

Additional Information

Anti-KDM4E

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 390245
• UniProt: B2RXH2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLTLGMSARVLLPSTGSWGSGRGR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemical staining of human stomach, lower shows strong nuclear and cytoplasmic positivity in glandular cells.