Anti-KDM4E, Rabbit, Polyclonal

Catalog Number: ATA-HPA051740
Article Name: Anti-KDM4E, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA051740
Supplier Catalog Number: HPA051740
Alternative Catalog Number: ATA-HPA051740-100,ATA-HPA051740-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: JMJD2E, KDM4DL
lysine (K)-specific demethylase 4E
Anti-KDM4E
Clonality: Polyclonal
Isotype: IgG
NCBI: 390245
UniProt: B2RXH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLTLGMSARVLLPSTGSWGSGRGR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human stomach, lower shows strong nuclear and cytoplasmic positivity in glandular cells.