Anti-IQCG
Artikelnummer:
ATA-HPA051981
- Bilder (8)
| Artikelname: | Anti-IQCG |
| Artikelnummer: | ATA-HPA051981 |
| Hersteller Artikelnummer: | HPA051981 |
| Alternativnummer: | ATA-HPA051981-100,ATA-HPA051981-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CFAP122, DKFZp434B227, DRC9 |
| IQ motif containing G |
| Anti-IQCG |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84223 |
| UniProt: | Q9H095 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IQCG |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human fallopian tube and duodenum tissues using Anti-IQCG antibody. Corresponding IQCG RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue. |
|
|
HPA051981-100ul |
|
|
|
|
|
HPA051981-100ul |
|
|
HPA051981-100ul |
Produktgarantie und fachkundiger Support
