Anti-IQCG

Catalog Number: ATA-HPA051981
Article Name: Anti-IQCG
Biozol Catalog Number: ATA-HPA051981
Supplier Catalog Number: HPA051981
Alternative Catalog Number: ATA-HPA051981-100,ATA-HPA051981-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CFAP122, DKFZp434B227, DRC9
IQ motif containing G
Anti-IQCG
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 84223
UniProt: Q9H095
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IQCG
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human fallopian tube and duodenum tissues using Anti-IQCG antibody. Corresponding IQCG RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human duodenum shows low expression as expected.
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
HPA051981-100ul
HPA051981-100ul
HPA051981-100ul