Anti-MUC21
Artikelnummer:
ATA-HPA052028
- Bilder (7)
| Artikelname: | Anti-MUC21 |
| Artikelnummer: | ATA-HPA052028 |
| Hersteller Artikelnummer: | HPA052028 |
| Alternativnummer: | ATA-HPA052028-100,ATA-HPA052028-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bCX31G15.2, C6orf205 |
| mucin 21, cell surface associated |
| Anti-MUC21 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | None |
| UniProt: | Q5SSG8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MUC21 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using HPA052028 antibody. Corresponding MUC21 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells. |
|
|
Immunohistochemical staining of human esophagus shows moderate membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA052028-100ul |
|
|
HPA052028-100ul |
|
|
HPA052028-100ul |
Produktgarantie und fachkundiger Support
