Anti-MUC21
Catalog Number:
ATA-HPA052028
- Images (7)
| Article Name: | Anti-MUC21 |
| Biozol Catalog Number: | ATA-HPA052028 |
| Supplier Catalog Number: | HPA052028 |
| Alternative Catalog Number: | ATA-HPA052028-100,ATA-HPA052028-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bCX31G15.2, C6orf205 |
| mucin 21, cell surface associated |
| Anti-MUC21 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | None |
| UniProt: | Q5SSG8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MUC21 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using HPA052028 antibody. Corresponding MUC21 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells. |
|
|
Immunohistochemical staining of human esophagus shows moderate membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA052028-100ul |
|
|
HPA052028-100ul |
|
|
HPA052028-100ul |
Product Guarantee and Expert Support
