Anti-PSMB7
Artikelnummer:
ATA-HPA052408
- Bilder (7)
| Artikelname: | Anti-PSMB7 |
| Artikelnummer: | ATA-HPA052408 |
| Hersteller Artikelnummer: | HPA052408 |
| Alternativnummer: | ATA-HPA052408-100,ATA-HPA052408-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Z |
| proteasome (prosome, macropain) subunit, beta type, 7 |
| Anti-PSMB7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5695 |
| UniProt: | Q99436 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMB7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human testis shows positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows moderate nuclear positivity in epidermal cells. |
|
|
Immunohistochemical staining of human liver shows positivity in hepatocytes. |
|
|
HPA052408-100ul |
|
|
HPA052408-100ul |
|
|
HPA052408-100ul |
Produktgarantie und fachkundiger Support
