Anti-PSMB7
Catalog Number:
ATA-HPA052408
- Images (7)
| Article Name: | Anti-PSMB7 |
| Biozol Catalog Number: | ATA-HPA052408 |
| Supplier Catalog Number: | HPA052408 |
| Alternative Catalog Number: | ATA-HPA052408-100,ATA-HPA052408-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Z |
| proteasome (prosome, macropain) subunit, beta type, 7 |
| Anti-PSMB7 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5695 |
| UniProt: | Q99436 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PSMB7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human testis shows positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows moderate nuclear positivity in epidermal cells. |
|
|
Immunohistochemical staining of human liver shows positivity in hepatocytes. |
|
|
HPA052408-100ul |
|
|
HPA052408-100ul |
|
|
HPA052408-100ul |
Product Guarantee and Expert Support
