Anti-NID2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA052460
Artikelname: Anti-NID2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA052460
Hersteller Artikelnummer: HPA052460
Alternativnummer: ATA-HPA052460-100,ATA-HPA052460-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NID2
nidogen 2 (osteonidogen)
Anti-NID2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 22795
UniProt: Q14112
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSIQPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line BJ shows localization to plasma membrane.
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-NID2 antibody. Corresponding NID2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis using Anti-NID2 antibody HPA052460 (A) shows similar pattern to independent antibody HPA058772 (B).