Anti-NID2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-NID2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA052460
• Supplier Catalog Number: HPA052460
• Alternative Catalog Number: ATA-HPA052460-100,ATA-HPA052460-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: NID2

Product Description

nidogen 2 (osteonidogen)

Additional Information

Anti-NID2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Isotype: IgG
• NCBI: 22795
• UniProt: Q14112
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSIQPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line BJ shows localization to plasma membrane.

Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-NID2 antibody. Corresponding NID2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human placenta shows high expression.

Immunohistochemical staining of human pancreas shows low expression as expected.

Western blot analysis using Anti-NID2 antibody HPA052460 (A) shows similar pattern to independent antibody HPA058772 (B).