Anti-DNAH9
Artikelnummer:
ATA-HPA052641
- Bilder (7)
| Artikelname: | Anti-DNAH9 |
| Artikelnummer: | ATA-HPA052641 |
| Hersteller Artikelnummer: | HPA052641 |
| Alternativnummer: | ATA-HPA052641-100,ATA-HPA052641-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357 |
| dynein, axonemal, heavy chain 9 |
| Anti-DNAH9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1770 |
| UniProt: | Q9NYC9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAH9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using HPA052641 antibody. Corresponding DNAH9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human bronchus shows strong positivity in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
HPA052641-100ul |
|
|
HPA052641-100ul |
|
|
HPA052641-100ul |
Produktgarantie und fachkundiger Support
