Anti-DNAH9
Catalog Number:
ATA-HPA052641
- Images (7)
| Article Name: | Anti-DNAH9 |
| Biozol Catalog Number: | ATA-HPA052641 |
| Supplier Catalog Number: | HPA052641 |
| Alternative Catalog Number: | ATA-HPA052641-100,ATA-HPA052641-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357 |
| dynein, axonemal, heavy chain 9 |
| Anti-DNAH9 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1770 |
| UniProt: | Q9NYC9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAH9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using HPA052641 antibody. Corresponding DNAH9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human bronchus shows strong positivity in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
HPA052641-100ul |
|
|
HPA052641-100ul |
|
|
HPA052641-100ul |
Product Guarantee and Expert Support
