Anti-TMEM119

Artikelnummer: ATA-HPA052650
Artikelname: Anti-TMEM119
Artikelnummer: ATA-HPA052650
Hersteller Artikelnummer: HPA052650
Alternativnummer: ATA-HPA052650-100,ATA-HPA052650-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TMEM119
transmembrane protein 119
Anti-TMEM119
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 338773
UniProt: Q4V9L6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMEM119
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human lymph node and liver tissues using HPA052650 antibody. Corresponding TMEM119 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody HPA052650 (A) shows similar protein distribution across tissues to independent antibody HPA051870 (B).
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human lymph node shows strong positivity in reticular fibers in germinal center cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in peritubular myoid cells.
Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in microglia.
HPA052650-100ul
HPA052650-100ul
HPA052650-100ul