Anti-TMEM119

Product Overview

• Article Name: Anti-TMEM119
• Biozol Catalog Number: ATA-HPA052650
• Supplier Catalog Number: HPA052650
• Alternative Catalog Number: ATA-HPA052650-100,ATA-HPA052650-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: TMEM119

Product Description

transmembrane protein 119

Additional Information

Anti-TMEM119

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 338773
• UniProt: Q4V9L6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TMEM119
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human lymph node and liver tissues using HPA052650 antibody. Corresponding TMEM119 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody HPA052650 (A) shows similar protein distribution across tissues to independent antibody HPA051870 (B).

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemical staining of human lymph node shows strong positivity in reticular fibers in germinal center cells.

Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in peritubular myoid cells.

Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in microglia.

HPA052650-100ul

HPA052650-100ul

HPA052650-100ul