Anti-TBC1D2B
Artikelnummer:
ATA-HPA052663
- Bilder (8)
| Artikelname: | Anti-TBC1D2B |
| Artikelnummer: | ATA-HPA052663 |
| Hersteller Artikelnummer: | HPA052663 |
| Alternativnummer: | ATA-HPA052663-100,ATA-HPA052663-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA1055 |
| TBC1 domain family, member 2B |
| Anti-TBC1D2B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.8 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23102 |
| UniProt: | Q9UPU7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VRSSQYDKYFTSSRLCGGVPKDTLELLHQKDDQILGLTSQLERFSLEKESLQQEVRTLKSKVGELNEQLGMLMETIQAKDE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TBC1D2B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas. |
|
|
Western blot analysis in human cell line RT-4 and human cell line HeLa. |
|
|
HPA052663-100ul |
|
|
|
|
|
|
|
|
HPA052663-100ul |
|
|
HPA052663-100ul |
Produktgarantie und fachkundiger Support
