Anti-TBC1D2B

Catalog Number: ATA-HPA052663
Article Name: Anti-TBC1D2B
Biozol Catalog Number: ATA-HPA052663
Supplier Catalog Number: HPA052663
Alternative Catalog Number: ATA-HPA052663-100,ATA-HPA052663-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1055
TBC1 domain family, member 2B
Anti-TBC1D2B
Clonality: Polyclonal
Concentration: 0.8 mg/ml
Isotype: IgG
NCBI: 23102
UniProt: Q9UPU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VRSSQYDKYFTSSRLCGGVPKDTLELLHQKDDQILGLTSQLERFSLEKESLQQEVRTLKSKVGELNEQLGMLMETIQAKDE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TBC1D2B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.
Western blot analysis in human cell line RT-4 and human cell line HeLa.
HPA052663-100ul
HPA052663-100ul
HPA052663-100ul