Anti-SLC7A5
Artikelnummer:
ATA-HPA052673
- Bilder (7)
| Artikelname: | Anti-SLC7A5 |
| Artikelnummer: | ATA-HPA052673 |
| Hersteller Artikelnummer: | HPA052673 |
| Alternativnummer: | ATA-HPA052673-100,ATA-HPA052673-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD98, D16S469E, E16, LAT1, MPE16 |
| solute carrier family 7 (amino acid transporter light chain, L system), member 5 |
| Anti-SLC7A5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8140 |
| UniProt: | Q01650 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC7A5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebellum shows strong membranous positivity in endothelial cells, as well as moderate immunoreactivity in neuropil. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA052673-100ul |
|
|
HPA052673-100ul |
|
|
HPA052673-100ul |
Produktgarantie und fachkundiger Support
