Anti-SLC7A5
Catalog Number:
ATA-HPA052673
- Images (7)
| Article Name: | Anti-SLC7A5 |
| Biozol Catalog Number: | ATA-HPA052673 |
| Supplier Catalog Number: | HPA052673 |
| Alternative Catalog Number: | ATA-HPA052673-100,ATA-HPA052673-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD98, D16S469E, E16, LAT1, MPE16 |
| solute carrier family 7 (amino acid transporter light chain, L system), member 5 |
| Anti-SLC7A5 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 8140 |
| UniProt: | Q01650 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC7A5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebellum shows strong membranous positivity in endothelial cells, as well as moderate immunoreactivity in neuropil. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA052673-100ul |
|
|
HPA052673-100ul |
|
|
HPA052673-100ul |
Product Guarantee and Expert Support
