Anti-NCCRP1
Artikelnummer:
ATA-HPA052812
- Bilder (9)
| Artikelname: | Anti-NCCRP1 |
| Artikelnummer: | ATA-HPA052812 |
| Hersteller Artikelnummer: | HPA052812 |
| Alternativnummer: | ATA-HPA052812-100,ATA-HPA052812-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FBXO50, LOC342897, NCCRP-1 |
| non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) |
| Anti-NCCRP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 342897 |
| UniProt: | Q6ZVX7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NCCRP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cervix, uterine shows positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human skin shows moderate positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA052812-100ul |
|
|
|
|
|
HPA052812-100ul |
|
|
HPA052812-100ul |
Produktgarantie und fachkundiger Support
