Anti-NCCRP1
Catalog Number:
ATA-HPA052812
- Images (9)
| Article Name: | Anti-NCCRP1 |
| Biozol Catalog Number: | ATA-HPA052812 |
| Supplier Catalog Number: | HPA052812 |
| Alternative Catalog Number: | ATA-HPA052812-100,ATA-HPA052812-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FBXO50, LOC342897, NCCRP-1 |
| non-specific cytotoxic cell receptor protein 1 homolog (zebrafish) |
| Anti-NCCRP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 342897 |
| UniProt: | Q6ZVX7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NCCRP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cervix, uterine shows positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human skin shows moderate positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA052812-100ul |
|
|
|
|
|
HPA052812-100ul |
|
|
HPA052812-100ul |
Product Guarantee and Expert Support
