Anti-LVRN
Artikelnummer:
ATA-HPA053254
- Bilder (7)
| Artikelname: | Anti-LVRN |
| Artikelnummer: | ATA-HPA053254 |
| Hersteller Artikelnummer: | HPA053254 |
| Alternativnummer: | ATA-HPA053254-100,ATA-HPA053254-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APQ, AQPEP, FLJ90650, TAQPEP |
| laeverin |
| Anti-LVRN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 206338 |
| UniProt: | Q6Q4G3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IPYPIKDVVLCYGIALGSDKEWDILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LVRN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA053254 antibody. Corresponding LVRN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in extravillous trophoblastic cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in decidual cells as expected. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
HPA053254-100ul |
|
|
HPA053254-100ul |
|
|
HPA053254-100ul |
Produktgarantie und fachkundiger Support
