Anti-LVRN
Catalog Number:
ATA-HPA053254
- Images (7)
| Article Name: | Anti-LVRN |
| Biozol Catalog Number: | ATA-HPA053254 |
| Supplier Catalog Number: | HPA053254 |
| Alternative Catalog Number: | ATA-HPA053254-100,ATA-HPA053254-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | APQ, AQPEP, FLJ90650, TAQPEP |
| laeverin |
| Anti-LVRN |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 206338 |
| UniProt: | Q6Q4G3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IPYPIKDVVLCYGIALGSDKEWDILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LVRN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human placenta and tonsil tissues using HPA053254 antibody. Corresponding LVRN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in extravillous trophoblastic cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in decidual cells as expected. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
HPA053254-100ul |
|
|
HPA053254-100ul |
|
|
HPA053254-100ul |
Product Guarantee and Expert Support
