Anti-GSN
Artikelnummer:
ATA-HPA054026
- Bilder (9)
| Artikelname: | Anti-GSN |
| Artikelnummer: | ATA-HPA054026 |
| Hersteller Artikelnummer: | HPA054026 |
| Alternativnummer: | ATA-HPA054026-100,ATA-HPA054026-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp313L0718 |
| gelsolin |
| Anti-GSN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2934 |
| UniProt: | P06396 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GSN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in dendritic cells. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in Langerhans cells. |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma. |
|
|
HPA054026-100ul |
|
|
|
|
|
HPA054026-100ul |
|
|
HPA054026-100ul |
Produktgarantie und fachkundiger Support
