Anti-GSN
Catalog Number:
ATA-HPA054026
- Images (9)
| Article Name: | Anti-GSN |
| Biozol Catalog Number: | ATA-HPA054026 |
| Supplier Catalog Number: | HPA054026 |
| Alternative Catalog Number: | ATA-HPA054026-100,ATA-HPA054026-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp313L0718 |
| gelsolin |
| Anti-GSN |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 2934 |
| UniProt: | P06396 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GSN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in dendritic cells. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in Langerhans cells. |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma. |
|
|
HPA054026-100ul |
|
|
|
|
|
HPA054026-100ul |
|
|
HPA054026-100ul |
Product Guarantee and Expert Support
